Topographic map and compass on lichen-covered rock. Navigation routefinding in the wilderness. Map is public domain
Topographic map and compass on lichen-covered rock. Navigation routefinding in the wilderness. Map is public domain.
View Full Image on Dreamstime
Keywords:
adventureanalogbackcountrybackgroundbackgroundsbearingclosecloseupcompassconceptdirectionfindinghikinglichencoveredmagneticmapnavigatenavigatingnavigationnobodynorthorienteeringoutdoorsrockrouteroutefindingtakingtechnologytopographictopographytravelwaywayfindingwilderness
Username: Mlharrisphotography
Editorial: No
Width: 3413 pixels
Height: 5120 pixels
Downloads: 0
Image ID: 153309278