Female trying to smell perfume bottle. Loss of smell due to sars-cov-2. Long covid syndrome.
Middle aged woman sniffing perfume bottle. Loss of smell due to coronavirus pandemic. Long-term effect of anosmia and receptor blindness. Concept of covid syndrome. Horizontal shot with copy space
View Full Image on Dreamstime
Keywords:
abilityabsenceanosmiaaromablindnessbottlebreathcaucasianconceptcopycoronacoronaviruscovidcovid19diseasedisordereffectfakefeelingfemalehealthhorizontalillnessinfluenzainhalelacklonglonglastinglongtermlossnasalodorofoflactionpandemicperfumepostcovidqualityreceptorsarscov2scentsensesicksmellsniffspacesymptomsyndrometasteviruswoman
Username: Natabene
Editorial: No
Width: 7559 pixels
Height: 5042 pixels
Downloads: 0
Image ID: 228992066