Little gull on a sunny autumn day
With fifteen little gulls foraging just off the shore, the difficulty was not finding motives but getting a reasonable distance to the motif. A nice change when photographing birds
View Full Image on Dreamstime
Keywords:
animalautumnavesbeakbirdblackbluedjurdvärgmÃÂ¥sfeatherflightflyflygandeflyingfÃÂ¥gelgullgullshydrocoloeushöstisolatedlaridaelittleminutusmÃÂ¥smÃÂ¥sfÃÂ¥glarnatureseaseagullskysverigeswedenwhitewildwildlifewingwingsöland
Username: Magnusrenmyr
Editorial: No
Width: 6581 pixels
Height: 3702 pixels
Downloads: 0
Image ID: 234292538