Hand writing sign Wireless Network. Business showcase nonobjective motif that cannot be described any other way. Crutial
Inspiration showing sign Wireless Network, Internet Concept nonobjective motif that cannot be described any other way. Crutial Informations Presented In Dialogue Balloon Over Cellphone.
View Full Image on Dreamstime
Keywords:
abstractdynamicelementsframefluidflowflyergradientgraphicgeometriclineliquidlogominimalmodernmagicpatternposterpresentationsignsplashshapesetprintpainttrendywavyamazingartbeautysymbolstyleoutlinedesignclassicnaturalcolorfulconceptlayoutlayerspolygonmosaic
Username: Nialowwa
Editorial: No
Width: 8000 pixels
Height: 4000 pixels
Downloads: 0
Image ID: 260041722