Generative AI Large collection of the worlds healthiest foods very high in antioxidants anthocyanins fibre protein
Generative AI : Large collection of the worlds healthiest foods very high in antioxidants anthocyanins fibre protein omega 3 lycopene vitamins minerals Plant based vegan health foo
View Full Image on Dreamstime
Keywords:
foodveghealtheatingbackgroundfitnessfruitlifestylehealthytopviewdietvegetablenaturalorganicnutritioningredientproteindietingnutritiousfiberantioxidantgrainssuperfoodvitaminlegumesfibreomegaimmunesystemlowcarbplantbasedethicaljerusalemartichokecollectionbalancedbarleygrasscleanflatlayfreshboosterboostingdefensebloodpressurecholesterolsuperveganveganismvegetarianvitalityworldshealthiestfoods
Username: Quantwarrior
Editorial: No
Width: 4368 pixels
Height: 2448 pixels
Downloads: 0
Image ID: 329416942