Creamy Berry Protein Shake in Tall Glass Topped with Fresh Strawberries Generative AI Illustration
A creamy berry protein shake in a tall glass, topped with fresh strawberries, blueberries, and raspberries, perfect for a post-workout boost or a healthy snack Generative AI Illustration
View Full Image on Dreamstime
Keywords:
fitnessgoalsfitnessboostworkoutpostworkoutmusclevitaminssnackfitnessenergyproteinfitnesssmoothiedairyfreefitnesslifestylefitnessdrinkrecoverydrinkwellnessdrinkhealthylivingsmoothieglassfitnessroutinebreakfaststrawberriesraspberriesshakeshakeingredientsfitnessnutritionhealthyantioxidantsberriesblueberriesworkoutfuelblendernutritiondrinkrecoverysmoothieenergyboostactivelifestyleveganpostexercisedrinknutritioncreamygymhealthfoodfitnesssnackgymsnackproteinsmoothiewellnessleanmusclefreshfruitproteinshakerefreshingberrytallglasstoppedperfectpost-post-workoutboostgenerative
Username: Podshutterstock
Editorial: No
Width: 4368 pixels
Height: 2448 pixels
Downloads: 0
Image ID: 337605851